PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005606m
Common NameEUTSA_v10005606mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family LFY
Protein Properties Length: 418aa    MW: 46225.9 Da    PI: 7.1193
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005606mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY621.71.3e-18913871386
          FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmksls 94 
                      mdpe f++ lf+w+p  a+++pp  + +  +  ++p++ ++aa  ++l +le lf ayG+r++t+akiaelGft+stL++mkd+el+d+m+sls
  Thhalv10005606m   1 MDPEGFTNGLFRWNPTRAMVQPPPPVPPPPQ--QSPVTPQTAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLLGMKDDELEDMMNSLS 92 
                      9*************87777777777766554..4444567777888899********************************************* PP

          FLO_LFY  95 eifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqeglseepvqeeke.aagsggeglgeaelvaaeekk 180
                      +ifr++llvGeryGikaavraerrrl+e  ee++++rr+ll      + +++aldalsqeglseepvq++ + +a+ +++g g +e+ +a+   
  Thhalv10005606m  93 HIFRWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaagDSGTHHALDALSQEGLSEEPVQQQDQnDAAGNNGGGGYWEAGQAK--- 183
                      **************************99544456778887778844344556***************996652444444454666665443... PP

          FLO_LFY 181 seeekkkaskkkqkrkkkkelkseededeeeeededeeg....sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkia 270
                          kk++   +++rkk   ++ e+d+d +e ed+d+++    +g  g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq+ia
  Thhalv10005606m 184 ---MKKQQ---QRRRKKPMVTSVETDDDGNEGEDDDGMDtgngGGGLGMERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIA 271
                      ...22222...22333333334445555555555555551122444566********************************************* PP

          FLO_LFY 271 kerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahpr 364
                      k+rGekcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvG+wrqacykplv+ia r+gwdidavfnahpr
  Thhalv10005606m 272 KDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNAHPR 365
                      ********************************************************************************************** PP

          FLO_LFY 365 LsiWYvPtkLrqLChlerskas 386
                      LsiWYvPtkLrqLChler++a+
  Thhalv10005606m 366 LSIWYVPTKLRQLCHLERNNAV 387
                      ******************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.3E-2021386IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MDPEGFTNGL FRWNPTRAMV QPPPPVPPPP QQSPVTPQTA AFGMRLGGLE GLFGAYGIRF  60
YTAAKIAELG FTASTLLGMK DDELEDMMNS LSHIFRWELL VGERYGIKAA VRAERRRLQE  120
EEEEESSRRR HLLLSAAGDS GTHHALDALS QEGLSEEPVQ QQDQNDAAGN NGGGGYWEAG  180
QAKMKKQQQR RRKKPMVTSV ETDDDGNEGE DDDGMDTGNG GGGLGMERQR EHPFIVTEPG  240
EVARGKKNGL DYLFHLYEQC REFLLQVQTI AKDRGEKCPT KVTNQVFRYA KKSGASYINK  300
PKMRHYVHCY ALHCLDEDAS NALRRAFKER GENVGSWRQA CYKPLVNIAC RHGWDIDAVF  360
NAHPRLSIWY VPTKLRQLCH LERNNAVAAA AALVGGISCT GSSASGRGGG GSEELRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1332244171194PROTEIN LEAFY
2vy2_A1e-1332244171194PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4471030.0DQ447103.1 Arabidopsis thaliana clone pENTR221-At5g61850 floral meristem identity control protein LEAFY (At5g61850) mRNA, complete cds.
GenBankDQ6533890.0DQ653389.1 Arabidopsis thaliana clone 0000013258_0000009567 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394462.10.0hypothetical protein EUTSA_v10005606mg
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLV4KWK80.0V4KWK8_EUTSA; Uncharacterized protein
STRINGAT5G61850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)